SCOPe 2.07: Domain d7kzcd1: 7kzc D:1-109

Lineage for d7kzcd1 (7kzc D:1-109)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7kzcd1: 7kzc D:1-109 [399563]
   Other proteins in same PDB: d7kzcd2, d7kzcl2
   automated match to d2rcsl1
   complexed with cl

Details for d7kzcd1

PDB Entry: 7kzc, 2.3 Å

PDB Description: potent sars-cov-2 binding and neutralization through maturation of iconic sars-cov-1antibodies

PDB Compounds: (D:) Fab light chain of m396-B10 antibody

SCOPe Domain Sequences for d7kzcd1:

Sequence; same for both SEQRES and ATOM records:

>d7kzcd1 b.1.1.0 (D:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdtysdyvfgtgtkvtvlrt

Timeline for d7kzcd1:

• d7kzcd1 is new in SCOPe 2.07-stable
  
• d7kzcd1 appears in the current release, SCOPe 2.08