Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (61 PDB entries) |
Domain d7lcib_: 7lci B: [399505] Other proteins in same PDB: d7lcig_ automated match to d3v5wb_ complexed with uk4 |
PDB Entry: 7lci (more details), 2.9 Å
SCOPe Domain Sequences for d7lcib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lcib_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} eldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyamh wgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnics iynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttftg htgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnafa tgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalka dragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d7lcib_: