Lineage for d7l9ta_ (7l9t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511730Species Mycolicibacterium smegmatis [TaxId:246196] [399503] (1 PDB entry)
  8. 2511731Domain d7l9ta_: 7l9t A: [399504]
    automated match to d3tqaa_
    complexed with dms, qkj, so4

Details for d7l9ta_

PDB Entry: 7l9t (more details), 1.8 Å

PDB Description: crystal structure of dihydrofolate reductase from mycolicibacterium smegmatis in complex with sddc-0001565 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d7l9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l9ta_ c.71.1.0 (A:) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
msmrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpg
rrnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpl
dgdarapvlddswvattgewqtstsglrfrfcsyrr

SCOPe Domain Coordinates for d7l9ta_:

Click to download the PDB-style file with coordinates for d7l9ta_.
(The format of our PDB-style files is described here.)

Timeline for d7l9ta_: