Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Mycolicibacterium smegmatis [TaxId:246196] [399503] (1 PDB entry) |
Domain d7l9ta_: 7l9t A: [399504] automated match to d3tqaa_ complexed with dms, qkj, so4 |
PDB Entry: 7l9t (more details), 1.8 Å
SCOPe Domain Sequences for d7l9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l9ta_ c.71.1.0 (A:) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]} msmrliwaqstsgiigrdnsipwrlpedlarfkemtmghpvvmgrltweslpasvrplpg rrnivvtrdadyraegaevvtdlpdepdawviggaqiyamalaradrcevtevdialtpl dgdarapvlddswvattgewqtstsglrfrfcsyrr
Timeline for d7l9ta_: