Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries) |
Domain d6l9zb_: 6l9z B: [399486] Other proteins in same PDB: d6l9za_, d6l9zc_, d6l9zd_, d6l9ze_, d6l9zg_, d6l9zh_, d6l9zk_, d6l9zm_, d6l9zn_, d6l9zo_, d6l9zq_, d6l9zr_ automated match to d1tzyh_ protein/DNA complex; complexed with ca, cl, k |
PDB Entry: 6l9z (more details), 2.5 Å
SCOPe Domain Sequences for d6l9zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9zb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr ktvtamdvvyalkrqgrtlygfgg
Timeline for d6l9zb_: