Lineage for d7l6ca_ (7l6c A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451629Species Mycobacteroides abscessus [TaxId:561007] [394955] (2 PDB entries)
  8. 2451634Domain d7l6ca_: 7l6c A: [399461]
    automated match to d2h9ia_
    complexed with edo, na, nad

Details for d7l6ca_

PDB Entry: 7l6c (more details), 1.85 Å

PDB Description: crystal structure of enoyl-[acyl-carrier-protein] reductase inha from mycobacterium abscessus in complex with nad
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d7l6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l6ca_ c.2.1.2 (A:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
gllegkrilvtgiitdssiafhiakvaqeqgaelvltgfdrlrlieritqrlpkpaplle
ldvqneehlgslagrisevigegnkldgvvhsigfmpqsgmgvnpffdapfadvskgfhi
safsysslakavlpvmnrggsivgmdfdptrampaynwmtvaksalesvnrfvareagkv
gvrsnlvaagpirtlamsaivggalgdeagqqmqlleegwdqrapigwdmkdptpvaktv
callsdwlpattgdiifadggahtqll

SCOPe Domain Coordinates for d7l6ca_:

Click to download the PDB-style file with coordinates for d7l6ca_.
(The format of our PDB-style files is described here.)

Timeline for d7l6ca_: