SCOPe 2.07: Domain d7kloa1: 7klo A:287-344

Lineage for d7kloa1 (7klo A:287-344)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d7kloa1: 7klo A:287-344 [399318]
   Other proteins in same PDB: d7kloa2
   automated match to d2mnya_
   complexed with zn

Details for d7kloa1

PDB Entry: 7klo

PDB Description: solution structure of the phd1 domain of histone demethylase kdm5a

PDB Compounds: (A:) Lysine-specific demethylase 5A

SCOPe Domain Sequences for d7kloa1:

Sequence; same for both SEQRES and ATOM records:

>d7kloa1 g.50.1.0 (A:287-344) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svnfvdlyvcmfcgrgnnedklllcdgcddsyhtfclipplpdvpkgdwrcpkcvaee

Timeline for d7kloa1:

• d7kloa1 is new in SCOPe 2.07-stable
  
• d7kloa1 appears in the current release, SCOPe 2.08