Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein automated matches [191276] (4 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [399261] (2 PDB entries) |
Domain d7kovb_: 7kov B: [399268] automated match to d3ussa_ complexed with cl, fe, scn |
PDB Entry: 7kov (more details), 2.95 Å
SCOPe Domain Sequences for d7kovb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kovb_ b.82.1.19 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]} plrldrlrdfvsalgelldrhpdeesvlregrsllgelvrhddwlpeefaqpdperyqqy llhadsrqrfsvvsfvwgpgqttpvhdhrvwgligmlrgaedaqsfelgaeglrpigdpv rlspgqveavsprigdihrvfnaspdqpsisihvyganigavrravylpdgsekpfisgy snqflpniwdqske
Timeline for d7kovb_: