Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d7kjha1: 7kjh A:6-118 [399254] Other proteins in same PDB: d7kjha2, d7kjha3, d7kjhb2, d7kjhb3 automated match to d5da4a_ complexed with flc, nag |
PDB Entry: 7kjh (more details), 2 Å
SCOPe Domain Sequences for d7kjha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kjha1 b.1.1.1 (A:6-118) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqaggslrlsctasgrtfsntvmgwfrqapgkereflahilwsgglayyadsvk grftisrdnaknivylqmnslkpedtavyycaardfgfgnnydywgqgtqvtv
Timeline for d7kjha1: