Lineage for d7kbzb1 (7kbz B:14-134)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415735Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. 2415881Domain d7kbzb1: 7kbz B:14-134 [399220]
    Other proteins in same PDB: d7kbza2, d7kbzb2, d7kbzc2, d7kbzd2
    automated match to d2bc3b_
    complexed with cyn, km3

Details for d7kbzb1

PDB Entry: 7kbz (more details), 1.9 Å

PDB Description: artificial metalloproteins with dinuclear iron centers
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d7kbzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kbzb1 b.61.1.1 (B:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastyvghdtftkv
k

SCOPe Domain Coordinates for d7kbzb1:

Click to download the PDB-style file with coordinates for d7kbzb1.
(The format of our PDB-style files is described here.)

Timeline for d7kbzb1: