SCOPe 2.07: Domain d7kblb1: 7kbl B:1-114

Lineage for d7kblb1 (7kbl B:1-114)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:940] [399165] (3 PDB entries)

8. Domain d7kblb1: 7kbl B:1-114 [399214]
   Other proteins in same PDB: d7kbla2, d7kbla3, d7kbla4, d7kblb2, d7kblb3
   automated match to d1ulza2
   complexed with bct

Details for d7kblb1

PDB Entry: 7kbl, 2.3 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to bicarbonate

PDB Compounds: (B:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kblb1:

Sequence; same for both SEQRES and ATOM records:

>d7kblb1 c.30.1.0 (B:1-114) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
mfkkvlvanrgeiacrvirackelgiqtvaiyneiestarhvkmadeaymigvnpldtyl
naerivdlalevgaeaihpgygflaenehfarlceekgitfigphwkvielmgd

Timeline for d7kblb1:

• d7kblb1 is new in SCOPe 2.07-stable
  
• d7kblb1 appears in the current release, SCOPe 2.08