SCOPe 2.07: Domain d7jx2a1: 7jx2 A:0-133

Lineage for d7jx2a1 (7jx2 A:0-133)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d7jx2a1: 7jx2 A:0-133 [399050]
   Other proteins in same PDB: d7jx2a2
   automated match to d1eiia_
   complexed with vlp

Details for d7jx2a1

PDB Entry: 7jx2, 1.8 Å

PDB Description: cellular retinol-binding protein 2 (crbp2) in complex with 2- palmitoylglycerol

PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d7jx2a1:

Sequence; same for both SEQRES and ATOM records:

>d7jx2a1 b.60.1.2 (A:0-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkk

Timeline for d7jx2a1:

• d7jx2a1 is new in SCOPe 2.07-stable
  
• d7jx2a1 appears in the current release, SCOPe 2.08