Lineage for d7jvya_ (7jvy A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414734Protein automated matches [190295] (7 species)
    not a true protein
  7. 2414754Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 2414774Domain d7jvya_: 7jvy A: [399048]
    Other proteins in same PDB: d7jvyb2
    automated match to d1eiia_
    complexed with vkv

Details for d7jvya_

PDB Entry: 7jvy (more details), 1.3 Å

PDB Description: cellular retinol-binding protein 2 (crbp2) in complex with 2- arachidonylglyceryl ether
PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d7jvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jvya_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkk

SCOPe Domain Coordinates for d7jvya_:

Click to download the PDB-style file with coordinates for d7jvya_.
(The format of our PDB-style files is described here.)

Timeline for d7jvya_: