SCOPe 2.07: Domain d7d76g_: 7d76 G:

Lineage for d7d76g_ (7d76 G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (56 PDB entries)

8. Domain d7d76g_: 7d76 G: [398864]
   Other proteins in same PDB: d7d76b_
   automated match to d2trcg_
   complexed with clr, gxr, plm, y01

Details for d7d76g_

PDB Entry: 7d76, 3.1 Å

PDB Description: cryo-em structure of the beclomethasone-bound adhesion receptor gpr97- go complex

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d7d76g_:

Sequence; same for both SEQRES and ATOM records:

>d7d76g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfr

Timeline for d7d76g_:

• d7d76g_ is new in SCOPe 2.07-stable
  
• d7d76g_ appears in the current release, SCOPe 2.08