SCOPe 2.07: Domain d7dhea1: 7dhe A:2-146

Lineage for d7dhea1 (7dhe A:2-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [398830] (3 PDB entries)

8. Domain d7dhea1: 7dhe A:2-146 [398843]
   Other proteins in same PDB: d7dhea2, d7dheb2, d7dhec2, d7dhed2
   automated match to d2wmyd_
   complexed with b85

Details for d7dhea1

PDB Entry: 7dhe, 2.79 Å

PDB Description: vibrio vulnificus wzb in complex with benzylphosphonate

PDB Compounds: (A:) Protein-tyrosine-phosphatase

SCOPe Domain Sequences for d7dhea1:

Sequence; same for both SEQRES and ATOM records:

>d7dhea1 c.44.1.0 (A:2-146) automated matches {Vibrio vulnificus [TaxId: 672]}
fnkilvvcvgnicrsptgervlqkllpnktvasagiaaeksrligkpadamaievakenc
vdvenhqsqqltsalcsqydlilvmekghmealtqiapeargktmlfgqwigqkdipdpy
rqskeafvhayqlideaaqawakkl

Timeline for d7dhea1:

• d7dhea1 is new in SCOPe 2.07-stable
  
• d7dhea1 appears in the current release, SCOPe 2.08