Lineage for d7czxk1 (7czx K:1-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368489Domain d7czxk1: 7czx K:1-112 [398826]
    Other proteins in same PDB: d7czxk2, d7czxm2, d7czxn2
    automated match to d1dn0a1
    complexed with nag

Details for d7czxk1

PDB Entry: 7czx (more details), 2.8 Å

PDB Description: s protein of sars-cov-2 in complex bound with p5a-1b9
PDB Compounds: (K:) IG c168_light_IGKV4-1_IGKJ4,Uncharacterized protein

SCOPe Domain Sequences for d7czxk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7czxk1 b.1.1.0 (K:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgggtkvei

SCOPe Domain Coordinates for d7czxk1:

Click to download the PDB-style file with coordinates for d7czxk1.
(The format of our PDB-style files is described here.)

Timeline for d7czxk1: