Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (16 PDB entries) |
Domain d7db1a2: 7db1 A:90-226 [398816] Other proteins in same PDB: d7db1a1, d7db1b1 automated match to d3wywa2 complexed with dc1, dms, gsh |
PDB Entry: 7db1 (more details), 1.83 Å
SCOPe Domain Sequences for d7db1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7db1a2 a.45.1.0 (A:90-226) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qehaermkvlnlllfecsflfrrdsdfmsaivrqgfanvdvahherklteayiimeryle nsdfmagpqltladlsivttlstvnlmfplsqfprlrrwftamqqldayeancsgleklr qtmesvgsfqfpsssav
Timeline for d7db1a2: