Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (41 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [398754] (1 PDB entry) |
Domain d7cz3b_: 7cz3 B: [398774] automated match to d5eglb_ complexed with coa |
PDB Entry: 7cz3 (more details), 2.9 Å
SCOPe Domain Sequences for d7cz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cz3b_ d.38.1.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]} ekkfmreskaikttrvfpndlnnhqtlfggkllaeidsiasiaaarhsrkhcvtasidsv dfltpihqadsvcyeafvcytgkssmevfvkviaenllagerriaatcfitfvaikdgkp ssvpqvlpetqeehwlhktgleraenrkkgrlkskemaevltl
Timeline for d7cz3b_: