Lineage for d7d28a_ (7d28 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393878Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2393985Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2393986Protein automated matches [328523] (5 species)
    not a true protein
  7. 2393989Species Deinococcus radiodurans [TaxId:1299] [398722] (5 PDB entries)
  8. 2393990Domain d7d28a_: 7d28 A: [398757]
    automated match to d5ck9a_
    complexed with gol, mes

Details for d7d28a_

PDB Entry: 7d28 (more details), 1.5 Å

PDB Description: crystal structure of mazf (form-i) from deinococcus radiodurans
PDB Compounds: (A:) Endoribonuclease MazF

SCOPe Domain Sequences for d7d28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d28a_ b.34.6.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
sdyvpdaghlvwlnftpqagheqggrrpalvlspaayngvtglmqacpvtsrakgypfev
tlpahlgvsgvvladhcrsldwrsrraeqlaeapadvlaevrgklgsllgm

SCOPe Domain Coordinates for d7d28a_:

Click to download the PDB-style file with coordinates for d7d28a_.
(The format of our PDB-style files is described here.)

Timeline for d7d28a_: