Lineage for d7csyc_ (7csy C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2323047Species Pseudomonas aeruginosa [TaxId:208964] [398682] (3 PDB entries)
  8. 2323054Domain d7csyc_: 7csy C: [398704]
    automated match to d4mcxa_
    protein/DNA complex; complexed with dt

Details for d7csyc_

PDB Entry: 7csy (more details), 2.29 Å

PDB Description: pseudomonas aeruginosa antitoxin higa with higba promoter
PDB Compounds: (C:) HTH cro/C1-type domain-containing protein

SCOPe Domain Sequences for d7csyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7csyc_ a.35.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mrpihpgeilrdeflmefdispaalaralkvsaptvndivreqrgisadmairlgryfdt
saqfwmnlqseyslatayaangkqieheiepl

SCOPe Domain Coordinates for d7csyc_:

Click to download the PDB-style file with coordinates for d7csyc_.
(The format of our PDB-style files is described here.)

Timeline for d7csyc_: