Lineage for d7cd2o_ (7cd2 O:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565346Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2565558Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2565559Protein automated matches [190935] (19 species)
    not a true protein
  7. 2565573Species Bacillus subtilis [TaxId:645657] [356164] (4 PDB entries)
  8. 2565600Domain d7cd2o_: 7cd2 O: [398658]
    automated match to d1j7ha_
    mutant

Details for d7cd2o_

PDB Entry: 7cd2 (more details), 2.7 Å

PDB Description: crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein.
PDB Compounds: (O:) YabJ protein

SCOPe Domain Sequences for d7cd2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cd2o_ d.79.1.0 (O:) automated matches {Bacillus subtilis [TaxId: 645657]}
qgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavleeagasfetvvkatvfi
admeqfaevnevygqyfdthkparfcvevarlpkdalveievialvk

SCOPe Domain Coordinates for d7cd2o_:

Click to download the PDB-style file with coordinates for d7cd2o_.
(The format of our PDB-style files is described here.)

Timeline for d7cd2o_: