Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
Protein automated matches [190935] (19 species) not a true protein |
Species Bacillus subtilis [TaxId:645657] [356164] (4 PDB entries) |
Domain d7cd2o_: 7cd2 O: [398658] automated match to d1j7ha_ mutant |
PDB Entry: 7cd2 (more details), 2.7 Å
SCOPe Domain Sequences for d7cd2o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cd2o_ d.79.1.0 (O:) automated matches {Bacillus subtilis [TaxId: 645657]} qgiivnnmfyssgqipltpsgemvngdikeqthqvfsnlkavleeagasfetvvkatvfi admeqfaevnevygqyfdthkparfcvevarlpkdalveievialvk
Timeline for d7cd2o_: