SCOPe 2.07: Domain d7by4a2: 7by4 A:1111-1315

Lineage for d7by4a2 (7by4 A:1111-1315)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein automated matches [229100] (6 species)
   not a true protein

7. Species Clostridium tetani [TaxId:212717] [398500] (1 PDB entry)

8. Domain d7by4a2: 7by4 A:1111-1315 [398501]
   Other proteins in same PDB: d7by4a1
   automated match to d1a8da2
   complexed with btb, cso, gol, na

Details for d7by4a2

PDB Entry: 7by4, 1.5 Å

PDB Description: tetanus neurotoxin receptor binding domain

PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d7by4a2:

Sequence; same for both SEQRES and ATOM records:

>d7by4a2 b.42.4.2 (A:1111-1315) automated matches {Clostridium tetani [TaxId: 212717]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d7by4a2:

• d7by4a2 is new in SCOPe 2.07-stable
  
• d7by4a2 appears in the current release, SCOPe 2.08