Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d7brsc4: 7brs C:626-730 [398496] Other proteins in same PDB: d7brsa1, d7brsa3, d7brsa5, d7brsb1, d7brsb3, d7brsb5, d7brsc1, d7brsc3, d7brsc5, d7brsd1, d7brsd3, d7brsd5 automated match to d1jz8a2 complexed with dms, f4x, gol, mg, na |
PDB Entry: 7brs (more details), 2.67 Å
SCOPe Domain Sequences for d7brsc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7brsc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d7brsc4:
View in 3D Domains from same chain: (mouse over for more information) d7brsc1, d7brsc2, d7brsc3, d7brsc5 |