Lineage for d7brsc4 (7brs C:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373157Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2373204Domain d7brsc4: 7brs C:626-730 [398496]
    Other proteins in same PDB: d7brsa1, d7brsa3, d7brsa5, d7brsb1, d7brsb3, d7brsb5, d7brsc1, d7brsc3, d7brsc5, d7brsd1, d7brsd3, d7brsd5
    automated match to d1jz8a2
    complexed with dms, f4x, gol, mg, na

Details for d7brsc4

PDB Entry: 7brs (more details), 2.67 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d7brsc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brsc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d7brsc4:

Click to download the PDB-style file with coordinates for d7brsc4.
(The format of our PDB-style files is described here.)

Timeline for d7brsc4: