SCOPe 2.07: Domain d7beol2: 7beo L:108-214

Lineage for d7beol2 (7beo L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d7beol2: 7beo L:108-214 [398478]
   Other proteins in same PDB: d7beob1, d7beod1, d7beof1, d7beol1, d7beor_, d7beox_
   automated match to d1dn0a2
   complexed with act, cl, fuc, gol, nag

Details for d7beol2

PDB Entry: 7beo, 3.19 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-253h55l and covox-75 fabs

PDB Compounds: (L:) COVOX-253H55L light chain

SCOPe Domain Sequences for d7beol2:

Sequence; same for both SEQRES and ATOM records:

>d7beol2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7beol2:

• d7beol2 is new in SCOPe 2.07-stable
  
• d7beol2 appears in the current release, SCOPe 2.08