Lineage for d7aq4a1 (7aq4 A:53-507)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418312Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 2418313Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins)
  6. 2418327Protein automated matches [226900] (3 species)
    not a true protein
  7. 2418333Species Pseudomonas stutzeri [TaxId:316] [226185] (22 PDB entries)
  8. 2418358Domain d7aq4a1: 7aq4 A:53-507 [398307]
    Other proteins in same PDB: d7aq4a2, d7aq4b2, d7aq4b3
    automated match to d3sbpd1
    complexed with b3p, ca, cl, cua, cuz, fmt, k, na, trs, zn; mutant

Details for d7aq4a1

PDB Entry: 7aq4 (more details), 1.71 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase mutant, h583e
PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d7aq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aq4a1 b.69.3.1 (A:53-507) automated matches {Pseudomonas stutzeri [TaxId: 316]}
vkeskqkihvgpgelddyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgltne
srhimgdsakflngdchhphismtdgkydgkylfindkansrvarirldimkcdkmitvp
nvqaihglrlqkvphtkyvfanaefiiphpndgkvfdlqdensytmynaidaetmemafq
vivdgnldntdadytgrfaaatcynsekafdlggmmrnerdwvvvfdihaveaavkagdf
itlgdsktpvldgrkkdgkdskftryvpvpknphgcntssdgkyfiaagklsptcsmiai
dklpdlfagkladprdvivgepelglgplhttfdgrgnayttlfidsqvvkwnmeeavra
ykgekvnyikqkldvhyqpghlhaslcetneadgkwlvalskfskdrflpvgplhpendq
lidisgdemklvhdgptfaephdcimarrdqiktk

SCOPe Domain Coordinates for d7aq4a1:

Click to download the PDB-style file with coordinates for d7aq4a1.
(The format of our PDB-style files is described here.)

Timeline for d7aq4a1: