Lineage for d7av2a3 (7av2 A:461-610)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339168Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2339179Domain d7av2a3: 7av2 A:461-610 [398292]
    Other proteins in same PDB: d7av2a1, d7av2a2
    automated match to d3u9wa3
    complexed with act, imd, rzn, yb, zn

Details for d7av2a3

PDB Entry: 7av2 (more details), 1.95 Å

PDB Description: lta4 hydrolase in complex with fragment1
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d7av2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7av2a3 a.118.1.0 (A:461-610) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d7av2a3:

Click to download the PDB-style file with coordinates for d7av2a3.
(The format of our PDB-style files is described here.)

Timeline for d7av2a3: