Lineage for d7apya2 (7apy A:508-638)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382316Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)
  8. 2382347Domain d7apya2: 7apy A:508-638 [398277]
    Other proteins in same PDB: d7apya1, d7apyb1, d7apyb3
    automated match to d3sbqa2
    complexed with b3p, ca, cl, cua, cuz, fmt, k, na; mutant

Details for d7apya2

PDB Entry: 7apy (more details), 1.78 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase mutant, d576a
PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d7apya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7apya2 b.6.1.0 (A:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitniaqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d7apya2:

Click to download the PDB-style file with coordinates for d7apya2.
(The format of our PDB-style files is described here.)

Timeline for d7apya2: