SCOPe 2.07: Domain d6zyia1: 6zyi A:4-188

Lineage for d6zyia1 (6zyi A:4-188)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (51 PDB entries)

8. Domain d6zyia1: 6zyi A:4-188 [398056]
   automated match to d1hjoa1
   complexed with adp, ca

Details for d6zyia1

PDB Entry: 6zyi, 1.52 Å

PDB Description: crystal structure of hsp70 atpase domain in complex with adp and calcium

PDB Compounds: (A:) Heat shock 70kDa protein 1A variant

SCOPe Domain Sequences for d6zyia1:

Sequence; same for both SEQRES and ATOM records:

>d6zyia1 c.55.1.1 (A:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgdtkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

Timeline for d6zyia1:

• d6zyia1 is new in SCOPe 2.07-stable
  
• d6zyia1 appears in the current release, SCOPe 2.08