Lineage for d6ylma_ (6ylm A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547797Species Coral (Discosoma sp.) [TaxId:86600] [258320] (5 PDB entries)
  8. 2547801Domain d6ylma_: 6ylm A: [397962]
    automated match to d3srya_
    complexed with cl, nrq

Details for d6ylma_

PDB Entry: 6ylm (more details), 1.6 Å

PDB Description: mcherry
PDB Compounds: (A:) mCherry

SCOPe Domain Sequences for d6ylma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ylma_ d.22.1.0 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nmaiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilsp
qfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvk
lrgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttyka
kkpvqlpgaynvniklditshnedytiveqyeraegrhstggmdelyka

SCOPe Domain Coordinates for d6ylma_:

Click to download the PDB-style file with coordinates for d6ylma_.
(The format of our PDB-style files is described here.)

Timeline for d6ylma_: