Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d6z7wg1: 6z7w G:1-107 [397952] Other proteins in same PDB: d6z7wa2, d6z7wb1, d6z7wb2, d6z7wc2, d6z7wd1, d6z7wd2, d6z7we2, d6z7wf1, d6z7wf2, d6z7wg2, d6z7wh1, d6z7wh2 automated match to d1a5fl1 |
PDB Entry: 6z7w (more details), 2.42 Å
SCOPe Domain Sequences for d6z7wg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z7wg1 b.1.1.0 (G:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqsqkfmstsvgdrvsitckasqnvrtavawyqqrpgqspkaliylasnrhtgvpd rftgsgsgtdftltitnvqsedladyfclqhwnypltfgsgtkleik
Timeline for d6z7wg1: