Lineage for d6z7wg1 (6z7w G:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760285Domain d6z7wg1: 6z7w G:1-107 [397952]
    Other proteins in same PDB: d6z7wa2, d6z7wb1, d6z7wb2, d6z7wc2, d6z7wd1, d6z7wd2, d6z7we2, d6z7wf1, d6z7wf2, d6z7wg2, d6z7wh1, d6z7wh2
    automated match to d1a5fl1

Details for d6z7wg1

PDB Entry: 6z7w (more details), 2.42 Å

PDB Description: human insulin in complex with the analytical antibody hui-018 fab
PDB Compounds: (G:) MAb 6H10 light chain

SCOPe Domain Sequences for d6z7wg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z7wg1 b.1.1.0 (G:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsitckasqnvrtavawyqqrpgqspkaliylasnrhtgvpd
rftgsgsgtdftltitnvqsedladyfclqhwnypltfgsgtkleik

SCOPe Domain Coordinates for d6z7wg1:

Click to download the PDB-style file with coordinates for d6z7wg1.
(The format of our PDB-style files is described here.)

Timeline for d6z7wg1: