Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Serratia marcescens [TaxId:615] [348247] (5 PDB entries) |
Domain d6xexb1: 6xex B:2-250 [397909] Other proteins in same PDB: d6xexa2, d6xexb2 automated match to d3i3of_ complexed with edo, na, nad; mutant |
PDB Entry: 6xex (more details), 1.8 Å
SCOPe Domain Sequences for d6xexb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xexb1 c.2.1.0 (B:2-250) automated matches {Serratia marcescens [TaxId: 615]} rfdnkvvvitgagngmgeaaarrfsaegaivvladwakeavdkvaaslpkgramavhidv sdhvavekmmnevaeklgridvllnnagvhvagsvletsiddwrriagvdidgvvfcskf alphllktkgcivntasqsglggdwgaayycaakgavvnltramaldhggdgvrinsvcp slvktnmtngwpqeirdkfnerialgraaepeevaavmaflasddasfinganipvdgga tasdgapki
Timeline for d6xexb1: