Lineage for d6xewb1 (6xew B:2-251)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456809Species Serratia marcescens [TaxId:615] [348247] (5 PDB entries)
  8. 2456815Domain d6xewb1: 6xew B:2-251 [397903]
    Other proteins in same PDB: d6xewa2, d6xewb2
    automated match to d3i3of_
    complexed with adp, hbr, hbs, nad

Details for d6xewb1

PDB Entry: 6xew (more details), 2 Å

PDB Description: structure of serratia marcescens 2,3-butanediol dehydrogenase
PDB Compounds: (B:) 2,3-butanediol dehydrogenase

SCOPe Domain Sequences for d6xewb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xewb1 c.2.1.0 (B:2-251) automated matches {Serratia marcescens [TaxId: 615]}
rfdnkvvvitgagngmgeaaarrfsaegaivvladwakeavdkvaaslpkgramavhidv
sdhvavekmmnevaeklgridvllnnagvhvagsvletsiddwrriagvdidgvvfcskf
alphllktkgcivntasvsglggdwgaayycaakgavvnltramaldhggdgvrinsvcp
slvktnmtngwpqeirdkfnerialgraaepeevaavmaflasddasfinganipvdgga
tasdgqpkiv

SCOPe Domain Coordinates for d6xewb1:

Click to download the PDB-style file with coordinates for d6xewb1.
(The format of our PDB-style files is described here.)

Timeline for d6xewb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6xewb2