Lineage for d6vdrb_ (6vdr B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2301860Species Amphitrite ornata [TaxId:129555] [189339] (41 PDB entries)
  8. 2301900Domain d6vdrb_: 6vdr B: [397794]
    automated match to d5lkva_
    complexed with bml, edo, fde, so4

Details for d6vdrb_

PDB Entry: 6vdr (more details), 1.87 Å

PDB Description: crystal structure of dehaloperoxidase b in complex with cofactor iron(iii) deuteroporphyrin ix and substrate 4-bromophenol
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d6vdrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vdrb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d6vdrb_:

Click to download the PDB-style file with coordinates for d6vdrb_.
(The format of our PDB-style files is described here.)

Timeline for d6vdrb_: