SCOPe 2.07: Domain d6ttgb_: 6ttg B:

Lineage for d6ttgb_ (6ttg B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (21 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d6ttgb_: 6ttg B: [397740]
   automated match to d3u2ka_
   protein/DNA complex; complexed with ca, cl, gol, imd, mpd, nwk

Details for d6ttgb_

PDB Entry: 6ttg, 1.7 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with lmd62

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d6ttgb_:

Sequence, based on SEQRES records:

>d6ttgb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl
kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv
redsyhyeg

Sequence, based on observed residues (ATOM records):

>d6ttgb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
dsyhyeg

Timeline for d6ttgb_:

• d6ttgb_ is new in SCOPe 2.07-stable
  
• d6ttgb_ appears in the current release, SCOPe 2.08