Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (21 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries) |
Domain d6ttgb_: 6ttg B: [397740] automated match to d3u2ka_ protein/DNA complex; complexed with ca, cl, gol, imd, mpd, nwk |
PDB Entry: 6ttg (more details), 1.7 Å
SCOPe Domain Sequences for d6ttgb_:
Sequence, based on SEQRES records: (download)
>d6ttgb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv redsyhyeg
>d6ttgb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre dsyhyeg
Timeline for d6ttgb_: