Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Chlamydia trachomatis [TaxId:272561] [397652] (1 PDB entry) |
Domain d6v82b_: 6v82 B: [397653] automated match to d1wdwb_ complexed with llp, so4 |
PDB Entry: 6v82 (more details), 2.42 Å
SCOPe Domain Sequences for d6v82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v82b_ c.79.1.0 (B:) automated matches {Chlamydia trachomatis [TaxId: 272561]} fkhkhpfggaflpeellapiqnlkaeweilktqqsflseldcilknyagrqtpltevknf araidgprvflkredllhtgahklnnalgqcllakylgktrvvaetgagqhgvatataca ylgldcvvymgakdverqkpnvekmrflgaevvsvtkgscglkdavnqalqdwatthsft hyclgsalgplpypdivrffqsvisaevkeqihavagrdpdiliacigggsnaigffhhf ipnpkvqligveggglgissgkhaarfatgrpgvfhgfysyllqdddgqvlqthsisagl dypsvgpdhaemhesgrafytlatdeealrafflltrnegiipalesshalahlvsiaps lpkeqivivnlsgrgdkdlpqiirrnrgiye
Timeline for d6v82b_: