Lineage for d6v82b_ (6v82 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515254Species Chlamydia trachomatis [TaxId:272561] [397652] (1 PDB entry)
  8. 2515255Domain d6v82b_: 6v82 B: [397653]
    automated match to d1wdwb_
    complexed with llp, so4

Details for d6v82b_

PDB Entry: 6v82 (more details), 2.42 Å

PDB Description: crystal structure of tryptophan synthase from chlamydia trachomatis d/uw-3/cx
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6v82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v82b_ c.79.1.0 (B:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
fkhkhpfggaflpeellapiqnlkaeweilktqqsflseldcilknyagrqtpltevknf
araidgprvflkredllhtgahklnnalgqcllakylgktrvvaetgagqhgvatataca
ylgldcvvymgakdverqkpnvekmrflgaevvsvtkgscglkdavnqalqdwatthsft
hyclgsalgplpypdivrffqsvisaevkeqihavagrdpdiliacigggsnaigffhhf
ipnpkvqligveggglgissgkhaarfatgrpgvfhgfysyllqdddgqvlqthsisagl
dypsvgpdhaemhesgrafytlatdeealrafflltrnegiipalesshalahlvsiaps
lpkeqivivnlsgrgdkdlpqiirrnrgiye

SCOPe Domain Coordinates for d6v82b_:

Click to download the PDB-style file with coordinates for d6v82b_.
(The format of our PDB-style files is described here.)

Timeline for d6v82b_: