Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein automated matches [190472] (8 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [187695] (257 PDB entries) |
Domain d5rt8b1: 5rt8 B:3-169 [397481] Other proteins in same PDB: d5rt8b2 automated match to d2favb_ complexed with hlr |
PDB Entry: 5rt8 (more details), 1 Å
SCOPe Domain Sequences for d5rt8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rt8b1 c.50.1.2 (B:3-169) automated matches {SARS coronavirus [TaxId: 227859]} vnsfsgylkltdnvyiknadiveeakkvkptvvvnaanvylkhgggvagalnkatnnamq vesddyiatngplkvggscvlsghnlakhclhvvgpnvnkgediqllksayenfnqhevl lapllsagifgadpihslrvcvdtvrtnvylavfdknlydklvssfl
Timeline for d5rt8b1: