SCOPe 2.03: Domain d1c0aa2: 1c0a A:288-420

Lineage for d1c0aa2 (1c0a A:288-420)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.4: GAD domain-like [55261] (2 families)

5. Family d.74.4.1: GAD domain [55262] (2 proteins)
   has additional structures inserted in the common fold loops

6. Protein Prokaryotic AspRS, insert domain [55263] (2 species)

7. Species Escherichia coli [TaxId:562] [55264] (3 PDB entries)

8. Domain d1c0aa2: 1c0a A:288-420 [39731]
   Other proteins in same PDB: d1c0aa1, d1c0aa3
   protein/RNA complex; complexed with amo, amp, so4

Details for d1c0aa2

PDB Entry: 1c0a, 2.4 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase : trnaasp : aspartyl-adenylate complex

PDB Compounds: (A:) aspartyl tRNA synthetase

SCOPe Domain Sequences for d1c0aa2:

Sequence; same for both SEQRES and ATOM records:

>d1c0aa2 d.74.4.1 (A:288-420) Prokaryotic AspRS, insert domain {Escherichia coli [TaxId: 562]}
npmeltdvadllksvefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygak
glayikvnerakgleginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamg
alrlkvgkdlglt

Timeline for d1c0aa2:

• d1c0aa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c0aa2 appears in SCOPe 2.02
  
• d1c0aa2 appears in SCOPe 2.04
  
• d1c0aa2 appears in the current release, SCOPe 2.08