SCOPe 2.07: Domain d7l4aa1: 7l4a A:1-220

Lineage for d7l4aa1 (7l4a A:1-220)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Encephalitozoon cuniculi [TaxId:284813] [256235] (2 PDB entries)

8. Domain d7l4aa1: 7l4a A:1-220 [397304]
   Other proteins in same PDB: d7l4aa2
   automated match to d2h92a_
   complexed with cdp, edo, so4

Details for d7l4aa1

PDB Entry: 7l4a, 1.5 Å

PDB Description: crystal structure of cytidylate kinase from encephalitozoon cuniculi gb-m1 in complex with two cdp molecules

PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d7l4aa1:

Sequence; same for both SEQRES and ATOM records:

>d7l4aa1 c.37.1.0 (A:1-220) automated matches {Encephalitozoon cuniculi [TaxId: 284813]}
mktykiavdgpaasgksstsdlvarklgfshlisgnlyravtyglvrrfgevrpgdeeqk
rfvlelsievrnnrvfldgedvseslrkevvdrhvvsvarekyirekvftiqrsvidlek
rgivvdgrdiatrimpnadlkvfltaspetrarrrymeggsesyeellesikkrdhndrt
rehdplvatcdsiviendsmtleetadeiirlfrrvesfn

Timeline for d7l4aa1:

• d7l4aa1 is new in SCOPe 2.07-stable
  
• d7l4aa1 appears in the current release, SCOPe 2.08