Lineage for d6ri3c_ (6ri3 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2614025Family d.230.2.0: automated matches [191578] (1 protein)
    not a true family
  6. 2614026Protein automated matches [191015] (5 species)
    not a true protein
  7. 2614073Species Streptomyces davaonensis [TaxId:348043] [397264] (1 PDB entry)
  8. 2614076Domain d6ri3c_: 6ri3 C: [397273]
    automated match to d3oqta_

Details for d6ri3c_

PDB Entry: 6ri3 (more details), 2.4 Å

PDB Description: dodecin from streptomyces davaonensis
PDB Compounds: (C:) dodecin

SCOPe Domain Sequences for d6ri3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ri3c_ d.230.2.0 (C:) automated matches {Streptomyces davaonensis [TaxId: 348043]}
snhtyrvtdivgtspegvdqairnginrasqtlhnldwfevvevrgqlndgqiahwqvtm
kvgfrlde

SCOPe Domain Coordinates for d6ri3c_:

Click to download the PDB-style file with coordinates for d6ri3c_.
(The format of our PDB-style files is described here.)

Timeline for d6ri3c_: