Lineage for d7l32a_ (7l32 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552293Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2552307Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2552308Protein automated matches [191185] (6 species)
    not a true protein
  7. 2552312Species Burkholderia ambifaria [TaxId:398577] [397236] (1 PDB entry)
  8. 2552313Domain d7l32a_: 7l32 A: [397240]
    automated match to d1fm0e_
    complexed with br

Details for d7l32a_

PDB Entry: 7l32 (more details), 1.9 Å

PDB Description: molybdopterin biosynthesis moae protein from burkholderia ambifaria mc40-6
PDB Compounds: (A:) MPT synthase subunit 2

SCOPe Domain Sequences for d7l32a_:

Sequence, based on SEQRES records: (download)

>d7l32a_ d.41.5.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
atiriqtddfdlnaevaalrarnpkigalacfvgtvrdlnegdsvaamelehypgmteka
lekiaaeagrrwpgidvaivhrvgrllpldqivmvatvashrgdafascefvmdylktea
pfwkkettpdgerwvdarstddaalarwgve

Sequence, based on observed residues (ATOM records): (download)

>d7l32a_ d.41.5.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
atiriqtddfdlnaevaalrarnpkigalacfvgtvrdlamelehypgmtekalekiaae
agrrwpgidvaivhrvgrllpldqivmvatvashrgdafascefvmdylkteapfwkket
tpdgerwvdarstddaalarwgve

SCOPe Domain Coordinates for d7l32a_:

Click to download the PDB-style file with coordinates for d7l32a_.
(The format of our PDB-style files is described here.)

Timeline for d7l32a_: