Lineage for d7kk4b1 (7kk4 B:662-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325420Domain d7kk4b1: 7kk4 B:662-796 [397214]
    Other proteins in same PDB: d7kk4a2, d7kk4b2
    automated match to d4hhyd1
    complexed with 09l

Details for d7kk4b1

PDB Entry: 7kk4 (more details), 1.96 Å

PDB Description: structure of the catalytic domain of parp1 in complex with olaparib
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7kk4b1:

Sequence, based on SEQRES records: (download)

>d7kk4b1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d7kk4b1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfkppllnnadsvqakvemldnlldievaysllrgskdp
idvnyek

SCOPe Domain Coordinates for d7kk4b1:

Click to download the PDB-style file with coordinates for d7kk4b1.
(The format of our PDB-style files is described here.)

Timeline for d7kk4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kk4b2