SCOPe 2.04: Domain d1b4ba_: 1b4b A:

Lineage for d1b4ba_ (1b4b A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
   automatically mapped to Pfam PF02863

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)

8. Domain d1b4ba_: 1b4b A: [39718]
   complexed with arg

Details for d1b4ba_

PDB Entry: 1b4b, 2.2 Å

PDB Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus

PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d1b4ba_:

Sequence; same for both SEQRES and ATOM records:

>d1b4ba_ d.74.2.1 (A:) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

Timeline for d1b4ba_:

• d1b4ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4ba_ appears in SCOPe 2.03
  
• d1b4ba_ appears in SCOPe 2.05
  
• d1b4ba_ appears in the current release, SCOPe 2.08