Lineage for d7kodd_ (7kod D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315958Species Mus musculus [TaxId:10090] [355187] (7 PDB entries)
  8. 2315962Domain d7kodd_: 7kod D: [397091]
    automated match to d5up8a_

Details for d7kodd_

PDB Entry: 7kod (more details), 1.66 Å

PDB Description: cryo-em structure of heavy chain mouse apoferritin
PDB Compounds: (D:) ferritin heavy chain

SCOPe Domain Sequences for d7kodd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kodd_ a.25.1.1 (D:) automated matches {Mus musculus [TaxId: 10090]}
psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk
ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d7kodd_:

Click to download the PDB-style file with coordinates for d7kodd_.
(The format of our PDB-style files is described here.)

Timeline for d7kodd_: