Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382084] (300 PDB entries) |
Domain d7jq1a_: 7jq1 A: [396983] automated match to d3ea8a_ complexed with vhj |
PDB Entry: 7jq1 (more details), 1.65 Å
SCOPe Domain Sequences for d7jq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jq1a_ b.47.1.4 (A:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddvvycprhvictsedmlnpnyedllir ksnhnflvqagnvqlrvighsmqncvlklkvdtanpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnftikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegn fygpfvdrqtaqaagtdttitvnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaslkellqngmngrtilgsalledeftpfdvvrqc sgvtfq
Timeline for d7jq1a_: