SCOPe 2.07: Domain d7dfma1: 7dfm A:1-190

Lineage for d7dfma1 (7dfm A:1-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [396913] (3 PDB entries)

8. Domain d7dfma1: 7dfm A:1-190 [396941]
   Other proteins in same PDB: d7dfma2, d7dfmb2, d7dfmc2, d7dfmd2
   automated match to d5ej3a_
   complexed with cl

Details for d7dfma1

PDB Entry: 7dfm, 2.4 Å

PDB Description: crystal structure of glycoside hydrolase family 11 beta-xylanase from streptomyces olivaceoviridis e-86

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d7dfma1:

Sequence; same for both SEQRES and ATOM records:

>d7dfma1 b.29.1.11 (A:1-190) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
atvittnqtgtnngfyysfwtdgggsvsmtlnsggnystswtncgnfvagkgwsnggrrn
vqysgsfypsgngylalygwtsnplveyyivdnwgnyrptgtykgtvtsdggtydvyqtt
rynapsvegtktfnqywsvrqskrtggtittgnhfdawarygmqlgsfsyymilategyq
ssgssnltvs

Timeline for d7dfma1:

• d7dfma1 is new in SCOPe 2.07-stable
  
• d7dfma1 appears in the current release, SCOPe 2.08