Lineage for d7d6ma1 (7d6m A:6-264)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502746Species Tick-borne encephalitis virus [TaxId:11084] [396922] (1 PDB entry)
  8. 2502747Domain d7d6ma1: 7d6m A:6-264 [396923]
    Other proteins in same PDB: d7d6ma2, d7d6mb2
    automated match to d3elwa_
    complexed with sam

Details for d7d6ma1

PDB Entry: 7d6m (more details), 1.89 Å

PDB Description: crystal structure of tick-borne encephalitis virus methyltransferase
PDB Compounds: (A:) Tick-borne encephalitis virus methyltransferase

SCOPe Domain Sequences for d7d6ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d6ma1 c.66.1.0 (A:6-264) automated matches {Tick-borne encephalitis virus [TaxId: 11084]}
mtlgdlwkrklngctkeeffayrrtgileterdkarellrrgetnmglavsrgtaklawl
eergyatlkgevvdlgcgrggwsyyaasrpavmsvkaytiggkghetpkmvtslgwnlik
fragmdvfsmqphradtimcdigesnpdavvegertrkvillmeqwknrnptatcvfkvl
apyrpeviealhrfqlqwggglvrtpfsrnsthemyystavtgnivnsvniqsrkllarf
gdqrgptrvpeldlgvgtr

SCOPe Domain Coordinates for d7d6ma1:

Click to download the PDB-style file with coordinates for d7d6ma1.
(The format of our PDB-style files is described here.)

Timeline for d7d6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7d6ma2