SCOPe 2.07: Domain d7a62c1: 7a62 C:15-403

Lineage for d7a62c1 (7a62 C:15-403)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
   multihelical; bundle, contains interrupted helices

4. Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families)
   contains heme-dependent enzymes

5. Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins)
   Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)

6. Protein automated matches [190585] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187592] (47 PDB entries)

8. Domain d7a62c1: 7a62 C:15-403 [396860]
   Other proteins in same PDB: d7a62a2, d7a62b2, d7a62c2, d7a62d2
   automated match to d5wmxb_
   complexed with cl, gol, hem

Details for d7a62c1

PDB Entry: 7a62, 2.44 Å

PDB Description: structure of human indoleamine-2,3-dioxygenase 1 (hido1) with a complete jk loop

PDB Compounds: (C:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d7a62c1:

Sequence; same for both SEQRES and ATOM records:

>d7a62c1 a.266.1.2 (C:15-403) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanw
kkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerd
tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsedpskl
eakgtggtdlmnflktvrstteksllkeg

Timeline for d7a62c1:

• d7a62c1 is new in SCOPe 2.07-stable
  
• d7a62c1 appears in the current release, SCOPe 2.08