Lineage for d7b3ol1 (7b3o L:1-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366250Domain d7b3ol1: 7b3o L:1-108 [396857]
    Other proteins in same PDB: d7b3oe_, d7b3ol2
    automated match to d1n0xl1

Details for d7b3ol1

PDB Entry: 7b3o (more details), 2 Å

PDB Description: crystal structure of the sars-cov-2 rbd in complex with ste90-c11 fab
PDB Compounds: (L:) light chain of Fab fragment

SCOPe Domain Sequences for d7b3ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b3ol1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspsflsasvgdrvtitcrasqgissylawyqqkpgkapklliyaastlqsgvps
rfsgsgsgteftltisslqpedfatyycqqlnsyppftfgpgtkvdik

SCOPe Domain Coordinates for d7b3ol1:

Click to download the PDB-style file with coordinates for d7b3ol1.
(The format of our PDB-style files is described here.)

Timeline for d7b3ol1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7b3ol2
View in 3D
Domains from other chains:
(mouse over for more information)
d7b3oe_