SCOPe 2.07: Domain d7bscl1: 7bsc L:20-129

Lineage for d7bscl1 (7bsc L:20-129)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7bscl1: 7bsc L:20-129 [396833]
   Other proteins in same PDB: d7bscl2
   automated match to d1dn0a1

Details for d7bscl1

PDB Entry: 7bsc, 2.31 Å

PDB Description: complex structure of 1g5.3 fab bound to denv2 ns1c

PDB Compounds: (L:) 1G5.3 Fab Light Chain

SCOPe Domain Sequences for d7bscl1:

Sequence; same for both SEQRES and ATOM records:

>d7bscl1 b.1.1.0 (L:20-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspaslavslgqratiscrasesveysgtslmhwyqqkpgqppklliyaasnves
gvparfsgsgsgtdfslnihpveeddiamyfcqqsrkvpytfgggtklel

Timeline for d7bscl1:

• d7bscl1 is new in SCOPe 2.07-stable
  
• d7bscl1 appears in the current release, SCOPe 2.08