Lineage for d7afqv_ (7afq V:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554303Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) (S)
    possible distant homologue of the type I KH domain lacking the KH motif
    automatically mapped to Pfam PF02033
  5. 2554304Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (2 proteins)
  6. 2554318Protein automated matches [386932] (2 species)
    not a true protein
  7. 2554321Species Escherichia coli [TaxId:244319] [396816] (1 PDB entry)
  8. 2554322Domain d7afqv_: 7afq V: [396817]
    automated match to d1kkga_

Details for d7afqv_

PDB Entry: 7afq (more details)

PDB Description: ribosome binding factor a (rbfa)
PDB Compounds: (V:) ribosome-binding factor a

SCOPe Domain Sequences for d7afqv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7afqv_ d.52.7.1 (V:) automated matches {Escherichia coli [TaxId: 244319]}
pqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndkdedavka
gikalqeasgfirsllgkamrlrivpeltffyd

SCOPe Domain Coordinates for d7afqv_:

Click to download the PDB-style file with coordinates for d7afqv_.
(The format of our PDB-style files is described here.)

Timeline for d7afqv_: