Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) possible distant homologue of the type I KH domain lacking the KH motif automatically mapped to Pfam PF02033 |
Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (2 proteins) |
Protein automated matches [386932] (2 species) not a true protein |
Species Escherichia coli [TaxId:244319] [396816] (1 PDB entry) |
Domain d7afqv_: 7afq V: [396817] automated match to d1kkga_ |
PDB Entry: 7afq (more details)
SCOPe Domain Sequences for d7afqv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7afqv_ d.52.7.1 (V:) automated matches {Escherichia coli [TaxId: 244319]} pqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndkdedavka gikalqeasgfirsllgkamrlrivpeltffyd
Timeline for d7afqv_: