Lineage for d7a17b_ (7a17 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369732Domain d7a17b_: 7a17 B: [396815]
    Other proteins in same PDB: d7a17d_, d7a17f_
    automated match to d4nc2b_
    complexed with gol, ip9, mg, po4

Details for d7a17b_

PDB Entry: 7a17 (more details), 2.73 Å

PDB Description: crystal structure of the 5-phosphatase domain of synaptojanin1 bound to its substrate dic8-pi(3,4,5)p3 in complex with a nanobody
PDB Compounds: (B:) Nanobody 13015

SCOPe Domain Sequences for d7a17b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a17b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvt

SCOPe Domain Coordinates for d7a17b_:

Click to download the PDB-style file with coordinates for d7a17b_.
(The format of our PDB-style files is described here.)

Timeline for d7a17b_: