Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
Domain d7a17b_: 7a17 B: [396815] Other proteins in same PDB: d7a17d_, d7a17f_ automated match to d4nc2b_ complexed with gol, ip9, mg, po4 |
PDB Entry: 7a17 (more details), 2.73 Å
SCOPe Domain Sequences for d7a17b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a17b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvt
Timeline for d7a17b_: